Detailed information on CNT30366015


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676610Sorghum bicolorSetaria viridis53.2935.0491.01178forward
CNT3017870Sorghum bicolorZea mays53.8944.4493.89180forward
CNT30339804Sorghum bicolorEragrostis tef34.1310.9788.6114forward
CNT30603977Sorghum bicolorOryza punctata27.5422.8984.7892forward

Expression of CNT30366015

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MQEEVGRNWEMKEEASMDCGLEEEVSKHQKLDGEVSMHQKLGEEVSKQQKLEEEESK*

>peptide 2 (51 aa)
DWDCEEVVGDAGRGGQELGDEGRGEHGLWIGGRGEQAPEAGWRGEHAPEAG*

Sequence

>CNT30366015
GACTGGGACTGTGAGGAGGTAGTAGGAGATGCAGGAAGAGGTGGGCAGGAACTGGGAGATGAAGGAAGAGGCGAGCATGGACTGTGGATTGGAGGAAGAG
GTGAGCAAGCACCAGAAGCTGGATGGAGAGGTGAGCATGCACCAGAAGCTGGGTGAAGAGGTGAGCAAGCAGCAGAAGCTGGAAGAAGAGGAGAGCAAGT
AGCAGAAGCTGGAGGAAGAGGTAAGGGATGTGGTGGGCTCCTCAACCCATCCATCTTTCTTACTGGTGACCTCGGGCTAAAACCAAATTCTCTAGAATTT
CCATTGCTCACAGCGAAGACATGGCCTTTTGGGA