Detailed information on CNT30361540


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30278778Sorghum bicolorChenopodium quinoa31.6527.7785.51138forward
CNT30727179Sorghum bicolorCorchorus capsularis34.8628.281.58152forward
CNT30182054Sorghum bicolorSecale cereale18.3526.4986.2580forward
CNT30683583Sorghum bicolorTriticum urartu57.863.4889.29252forward
CNT30595951Sorghum bicolorOryza meridionalis33.2667.4491.03145forward
CNT3050887Sorghum bicolorCucumis sativus30.546.6782.71133forward

Expression of CNT30361540

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MFSHRPWETAVWVPSLRLKGYPRTKSAPSR*

>peptide 2 (69 aa)
MSSSSLSSGVEGTDAPGTVTVPAIAAGRGGGGGARASGSRSLCPLSALCYRTGPGGGWGGDLGSRGGWEA

>peptide 3 (80 aa)
LDQLCGSIIVRDVQPQAMGDSSVGTLPEAEGVSTHKVSTLAVGVIQGVEEERGGRAGRRASTSRGSRGCGSSGSRCPARP*

Sequence

>CNT30361540
GGCTTGACCAGCTGTGTGGGAGCATCATAGTCAGGGATGTTCAGCCACAGGCCATGGGAGACAGCAGTGTGGGTACCCTCCCTGAGGCTGAAGGGGTATC
CACGCACAAAGTCAGCACCCTCGCGGTAGGGGTCATACAGGGTGTTGAAGAAGAACGGGGTGGTAGGGCTGGAAGAAGGGCCTCCACATCTCGAGGAAGT
CGAGGTTGCGGATCGTCGGGATCACGATGTCCAGCTCGTCCTTGAGCAGCGGCGTCGAGGGGACCGACGCCCCCGGGACCGTCACCGTGCCCGCCATTGC
CGCAGGTCGTGGTGGTGGTGGTGGTGCTCGCGCCTCCGGATCTCGATCTCTCTGCCCCCTCTCCGCTCTCTGCTACCGGACCGGACCGGGAGGTGGGTGG
GGAGGAGATCTTGGGAGCAGAGGAGGTTGGGAGGCG