Detailed information on CNT303439


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30362631Zea maysSorghum bicolor37.1635.6792.27453forward

Expression of CNT303439

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MLSLHLHASPPALMQPAVSIMQKKSSYLVNC*

>peptide 2 (31 aa)
MSPQETRQRALVDCNGGEEVIVLFHLAEYGS*

>peptide 3 (50 aa)
PNFTLRRNQFASARTERLNPTAAPRASIPQCPQQRQFVGLPRRTRRAERG*

>peptide 4 (58 aa)
ELHTPTEPIRIRTDGTSEPHRRTARVHPPMPPAAAVRRAPSPDAAGGARLAAEQASGP*

>peptide 5 (35 aa)
MLLGVSSLSTDFLLVVDRSKKRLSLLACHFAFRCS*

>peptide 6 (38 aa)
MRTRKPIVFCSIVFSSRILGQRLTCICASVFQAGKTCI*

>peptide 7 (63 aa)
MFLTGTMGMGIAVALVLNSSRGYCPRPDQYAVSPSPCFTSGIDAASCINYAKEKFLSGKLLMN*

Sequence

>CNT303439
CCGAACTTCACACTCCGACGGAACCAATTCGCATCCGCACGGACGGAACGTCTGAACCCCACCGCCGCACCGCGCGCGTCCATCCCCCAATGCCCCCAGC
AGCGGCAGTTCGTCGGGCTCCCTCGCCGGACGCGGCGGGCGGAGCGAGGCTAGCCGCGGAGCAAGCCTCTGGCCCGTGAGAAACATGTCTCCACAGGAGA
CACGGCAACGCGCCCTTGTAGATTGCAACGGCGGAGAGGAGGTTATTGTGCTGTTCCATTTGGCTGAATACGGAAGTTAATGGTGGTTGAGTGCAAGAAA
AGAAATTTAACTAACACTGTAAAGATCGAGGAATATAGAAACAGAGCTAATTGACACTAGTGATGAAAACAGTCTCATGACTTGTGAAAGCTTGATGGTC
ACTGCTTGCTGACTGGTGAGCAGCAATAGGGCTTGTCTAGAAAGTGAGGTACAGACATAAGGCAACCTTGCATTCCTGATCAGGTATCACTCGAGTGTGT
AGGTTTTTCCGGGATGCAGACAGATCATGAGAGATTAGACTGTCTTCGAAGCCAATGCTGCTGGGAGTTTCTAGTTTATCAACAGATTTCCTCTTAGTTG
TTGATCGCAGCAAGAAACGGCTGTCCTTGCTAGCTTGTCATTTCGCTTTTAGGTGTTCGTAGGTAAGAAAAACATGCGACAGAACCAGGCATCGTTGACA
CTTGTTAGACAGCAACGATGATGACATCGCCATTTTCTAGAGAACGACGTCAATGCGGACAAGAAAGCCAATTGTTTTTTGTTCAATAGTTTTTTCATCT
CGTATTCTTGGACAAAGGTTAACCTGTATTTGTGCTTCTGTCTTTCAGGCAGGAAAAACATGTATCTGACTCTATCCGATGTTTCTCACGGGCACCATGG
GAATGGGAATTGCTGTTGCCCTCGTTTTAAACTCATCTAGAGGATATTGCCCACGCCCAGATCAATATGCTGTCTCTCCATCTCCATGCTTCACCTCCGG
CATTGATGCAGCCAGCTGTATCAATTATGCAAAAGAAAAGTTCCTATCTGGTAAACTGCTGATGAACTAGGAGCCTAGGACGACATGATTTTTTGTTTCG
CTTCAGTGCTTGATCAGTGAACCCGTCCACCACCCTCGAAGCTGCTGCTTCTGGTTGCCGGTTTTCATGTTTGGTTAAGTTTTTTTTTTCCAACATGCTT
TTCTAAAAATCTTTTTTCT