Detailed information on CNT30339804


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676339Eragrostis tefSetaria viridis48.2210085.43501forward
CNT30524121Eragrostis tefSetaria italica37.0562.184.94385forward
CNT3017870Eragrostis tefZea mays27.6270.8682.58287forward
CNT30366015Eragrostis tefSorghum bicolor10.9734.1388.6114forward
CNT30603977Eragrostis tefOryza punctata30.1377.8679.55313forward
CNT30558445Eragrostis tefPanicum hallii37.6366.1684.65391forward

Expression of CNT30339804

Peptides detected in this lncRNA

>peptide 1 (75 aa)
MYRSLAISPFSIVIGIVSKWWEMKEEASKNWAMKEEVSQDWEPEEAVSKQQEQEEVAKDAVDSSNHPSFSLVTLG*

>peptide 2 (29 aa)
MYLLYNYSFECDQCIKFHTIAKCFHEVKR*

>peptide 3 (29 aa)
MFSDTRRRNLKELLMFPWHTTRQDMLVFI*

Sequence

>CNT30339804
CCATTTTCACTGCACCATTGGTCATAAAAACCTAAGAATACTTTTTTTACAATTATTTTTCTAGACATTCAGGTAAAACCCGAAGGCATGCAAATACATA
TCAATGATTTCGTATCAGAAAGGTGTGTTCAGATGAACTTTAATGTATCTACTGTATAACTACAGCTTTGAGTGCGATCAATGCATCAAGTTTCACACGA
TAGCTAAATGTTTCCATGAAGTAAAAAGGTGAGAAAAATGTGATACCTGTTAAATCCAAGGTAAACTTGGCCAAATGTACCGCTCCCTAGCAATTTCCCC
TTTTTCCATTGTGATTGGGATTGTAAGCAAGTGGTGGGAGATGAAGGAAGAGGCGAGCAAGAACTGGGCGATGAAGGAAGAGGTGAGCCAGGACTGGGAG
CCGGAGGAAGCGGTGAGCAAGCAGCAGGAGCAGGAGGAAGTGGCAAAGGATGCGGTGGACTCCTCAAACCATCCATCTTTCTCACTGGTGACCTTGGGCT
AAACCCAAATTCTCTTGAATTTCCATTGTTCAAAGCAAACACGCTTTTTGGGCCAGGTGAGAGACTTCTCGTTCTTGGACCAAATATATCTTCACATAAC
ATTCTGCCACGTGAACAACTGGTTTCACTAGTTGAGGGCTCATCACTGTGTAAATTATGTTCTCTGACACTAGACGCAGGAACCTCAAAGAACTTCTGAT
GTTCCCGTGGCATACTACAAGACAGGACATGCTTGTCTTCATTTAAGATTCTATCTGAGCTAGATGGTCCATTTCTCCCCCTGGCAAAAGCAGCTGGATC
CACAGGCCTAGAGGATACACCAAGCAACCAGTAACCGTCAGCCAACATATCAAAACGACTAATGTGAATTTTAATTATAAGGTACTGATACAAGTATCAC
AACTAGCACACAATGGCACCACATGACAATTTTACGTACTCCGAAGATGCCATAATTGAGTGCAAAACAAAAGGATTTCACTAACCAGTGTGCATCATCT
CTTGCAACGATAAACAAAGAGTCAGGGAAAGTATTTTAT