Detailed information on CNT30324863


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671969Asparagus officinalisSetaria viridis34.2226.2884.4277reverse complement
CNT30451383Asparagus officinalisSaccharum spontaneum34.2213.8585.7177reverse complement
CNT30231280Asparagus officinalisAnanas comosus34.229.9785.7177reverse complement
CNT30364600Asparagus officinalisSorghum bicolor34.2220.3284.4277reverse complement
CNT30496106Asparagus officinalisDigitaria exilis32.8910.5485.1474reverse complement

Expression of CNT30324863

Peptides detected in this lncRNA

>peptide 1 (30 aa)
ALPVVVKAKLISKTAEKKIKESGGAVVLTA*

>peptide 2 (42 aa)
MGGYFFWFILVFHWSMKILINGSGDLWVKPYKSSSYLYMFVYW

>peptide 3 (55 aa)
GIAGGREGEAHLEDGREEDQGVWRRRGAHRVNGGLFLLVYPCFPLVNENSYKWVG*

Sequence

>CNT30324863
GGCATTGCCGGTGGTCGTGAAGGCGAAGCTCATCTCGAAGACGGCCGAGAAGAAGATCAAGGAGTCTGGCGGCGCCGTGGTGCTCACCGCGTGAATGGGG
GGTTATTTCTTTTGGTTTATCCTTGTTTTCCATTGGTCAATGAAAATTCTTATAAATGGGTCGGGTGACCTCTGGGTCAAGCCATACAAATCAAGCTCGT
ACTTATACATGTTTGTATATTGGGG