Detailed information on CNT30287025


BLAST search results

BLAST vs Swiss-Prot:
sp|P49637|R27A3_ARATH, E-value = 3e-69

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671969Triticum aestivumSetaria viridis14.7327.6592.5981forward
CNT30641194Triticum aestivumNymphaea colorata21.8213.1690120forward
CNT30531335Triticum aestivumEucalyptus grandis19.6436.2487.96108forward
CNT30371729Triticum aestivumArabidopsis thaliana35.0935.3583.94193forward
CNT30161234Triticum aestivumPistacia vera34.9182.483.33192forward
CNT30553249Triticum aestivumOryza glaberrima37.0937.2393.14204forward
CNT30451383Triticum aestivumSaccharum spontaneum38.9138.4989.72214forward
CNT30231280Triticum aestivumAnanas comosus34.3624.4893.12189forward
CNT30650917Triticum aestivumRosa chinensis43.8237.7287.97241forward
CNT30362394Triticum aestivumSorghum bicolor69.2758.9889.76381forward
CNT30496106Triticum aestivumDigitaria exilis69.2754.2790.55381forward

Expression of CNT30287025

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MVLVEEDAVVVHASGVTAASGMLAVLAHTPVPGGHVAALLPVLLEAGRHRR

>peptide 2 (44 aa)
MRWWCMPPALPRPPGCLRCLPTRPCPADTWPRFFRFFLKRVVIAA

Sequence

>CNT30287025
AAAATTCTCATAAGATGTTGGTTTACCACACAGGAACCAGGATAACAAACTAACGATGTCTTGTTCAACACAAATTGCTGGTACGGGAAACAACTAATAG
TTCAGATATAATAGATCTCAAGGCACGGTCGCGAACAGAACCCTAGGCAACGAGCACGACAGCGCCGCCGCTTGGCCTTGACGACGATGGGCTTCTCCGG
CAGCATCCCCTTGCCGAGCACCTTGAAGTAGCCGAACTGCGAGACGTCGACCACGGGGGCCTTGTCGCCGCCGGCCTCGGCCGCCTTCTCGGACGGCACC
ATGGACCAGAGCCTCTCGACGTTGACCGTCGGGGTGTAGAACCTGTTGCTGAGCTTGTGGAAGTAGCGCATACCGACCTTGCCGAAGTAGCCGGGATGGT
ACTTGTCGAAGAGGATGCGGTGGTGGTGCATGCCTCCGGCGTTACCGCGGCCTCCGGGATGCTTGCGGTGCTTGCCCACACGCCCGTGCCCGGCGGACAC
GTGGCCGCGCTTCTTCCGGTTCTTCTTGAAGCGGGTCGTCATCGCCGCCG