Detailed information on CNT30278778


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692499Chenopodium quinoaOryza sativa26.5624.3182.58132forward
CNT30727179Chenopodium quinoaCorchorus capsularis26.9624.8685.82134forward
CNT30361540Chenopodium quinoaSorghum bicolor27.7731.6585.51138forward
CNT30595951Chenopodium quinoaOryza meridionalis26.5661.484.09132forward
CNT3050887Chenopodium quinoaCucumis sativus26.3645.9683.97131forward

Expression of CNT30278778

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MLSQRPWETAVGTPSRRLKGYPRTKSAPSRNGSYKVLKK*

>peptide 2 (59 aa)
FVPLKGLNELGGCIIVRDVEPETMGNSSRNTLAQAEGVSTDKVSTITEWVIQSVEEVRC*

>peptide 3 (49 aa)
MIWLEKWSPHFEEIEVSDCRNNNVELIFEQRSCRGRHCWERQGRREKVRV

Sequence

>CNT30278778
TTTTGTTCCTCTCAAGGGGCTTAACGAGTTGGGTGGGTGCATCATAGTCAGGGATGTTGAGCCAGAGACCATGGGAAACAGCAGTAGGAACACCCTCGCG
CAGGCTGAAGGGGTATCCACGGACAAAGTCAGCACCATCACGGAATGGGTCATACAAAGTGTTGAAGAAGTAAGGTGTTGATGGGCACAGAAGCCAAAAC
AACGACAAGCAGAATCCTTAAAAGAGATACAATTAGCTTTAGGACCTAAAATCCTGTTAATATCATCTCTGTTATAGAGTTCATAATCAAAACCATCAGG
AACATGAATCTTCTTTGTCGGATCACCATCTTGTACGATGATTAGATGATATGGTTGGAAAAATGGTCTCCACATTTCGAGGAAATCGAGGTTTCTGATT
GTCGGAATAACAATGTCGAGCTCATCTTTGAGCAGAGGAGTTGCAGGGGTCGACATTGTTGGGAAAGACAGGGGAGGAGAGAGAAAGTTAGAGTGAG