Detailed information on CNT30262462


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30262462

Peptides detected in this lncRNA

>peptide 1 (29 aa)
CSSSPSTVRCSSSRWTLPPAEPFPGWAGC*

>peptide 2 (86 aa)
MCKCRSHGTFPLFGLQSSHLNICYYHQDLHRRPLRPGSRPRFCSDRCALLLIEAWLLPRQPGIRRTLQSHPFSGLVDLAGELLHTP*

>peptide 3 (37 aa)
MAHLELSIPWDGSTKQPPRPTYLKFENRSRTLRPRCL*

>peptide 4 (33 aa)
ALPAHRPCGALPAAGPYLRLSRFQGGQAVKQKR*

>peptide 5 (63 aa)
MVRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQACSHSNPSQKIKVGRLCN

Sequence

>CNT30262462
TGCTCTTCCAGCCCATCGACCGTGCGGTGCTCTTCCAGCCGCTGGACCCTACCTCCGGCTGAGCCGTTTCCAGGGTGGGCAGGCTGTTAAACAGAAAAGA
TAACTCTTTCCGGAATTCCCGCCGACGTCTCCGGACTCCCTAACGTTGCCGTCAACCGCCACGTCCCGGTTCCGGAATTTTAACCGGATCCCCTTTCGAA
GTTCGCGCATAAGCGCTATCAGACGGGTTTCCCCCGACTCTTAGGATCGACTAACCCATGTGCAAGTGCCGTTCACATGGAACCTTTCCCCTCTTCGGCC
TTCAAAGTTCTCATTTGAATATTTGCTACTACCACCAAGATCTGCACCGACGGCCGCTCCGCCCGGGCTCGCGCCCTAGGTTTTGCAGCGACCGCTGCGC
CCTCCTACTCATCGAGGCCTGGCTCTTGCCCCGACAGCCGGGTATAAGGCGCACGCTTCAGAGCCATCCATTTTCGGGGCTAGTTGATTTGGCAGGTGAG
TTGTTACACACTCCTTAGCGGATTTCGACTTCCATGACCACCGTCCTGCTGTCTTAATCGACCAACACCCTTTGTGGGTTCTAGGTTAGCGCGCAGTTGG
GCACCGTAACCCGGCTTCCGGTTCATCCCGCATCGCCAGTTCTGCTTACCAAAAATGGCCCACTTGGAGCTCTCGATTCCGTGGGATGGCTCAACAAAGC
AGCCACCCCGTCCTACCTATTTAAAGTTTGAGAATAGGTCGAGGACATTGCGTCCCCGATGCCTCTAATCATTGGCTTTACCCGATAGAACTCGTTTCCG
AGCTCCAGCTATCCTGAGGGAAACTTCGGAGGGAACCAGCTACTAGATGGTTCGATTAGTCTTTCGCCCCTATACCCAAGTCAGACGAACGATTTGCACG
TCAGTATCGCTGCGGGCCTCCACCAGAGTTTCCTCTGGCTTCGCCCCGCTCAGGCATAGTTCACCATCTTTCGGGTCCCGACAGGCATGCTCACACTCGA
ACCCTTCTCAGAAAATCAAGGTCGGTCGGCTGTGCAATTC