Detailed information on CNT30210506


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Expression of CNT30210506

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MITRRIARPSCRRRIIQISAISTFDGRIVAYYGGDR*

>peptide 2 (30 aa)
RNATWLILPVVICLSQRLSHAYVSMNKFRL*

>peptide 3 (51 aa)
MVGLWPTMVVTGDGELRFDSGEGACETATTSKEGSRRANYPILTRGGSDNK*

>peptide 4 (36 aa)
ECYLVDPASSHMLVSKIKPCICKYEQIQTVKLRMAH*

Sequence

>CNT30210506
AGGAATGCTACCTGGTTGATCCTGCCAGTAGTCATATGCTTGTCTCAAAGATTAAGCCATGCATATGTAAGTATGAACAAATTCAGACTGTGAAACTGCG
AATGGCTCATTAAATCAGTTATAGTTTGTTTGATGGTATCTTGCTACTCGGATAACCGTAGTAATTCTAGAGCTAATACTGCAATAAACCCCGACTTCTG
GAAGGGTTGCATTTATTAGATAAAAGGTCATCGCGGGCTTTGCCCGTTGCTGTGATGATTCATGATAACTCGACGGATCGCACGGCCCTCGTGCCGGCGA
CGCATCATTCAAATTTCTGCCATATCAACTTTCGATGGTAGGATTGTGGCCTACTATGGTGGTGACAGGTGACGGAGAATTAAGGTTCGATTCCGGAGAG
GGAGCCTGTGAAACGGCTACCACATCCAAGGAAGGCAGCAGGCGCGCAAATTACCCAATCCTGACACGGGGAGGTAGTGACAATAAATAACAATACCGGG
CTCATACGAGTTTGGTAATTGGAATGAGTACAATCTAAATCCCTTAAGGAGGATCCATTTGAGGGCAAGTCTGGTGCCAGTAGTCACGGTAATTCCAACT
CCAATAGCGTATATTTAAGTTGTTGCAATTAAAAAGCTCGTAGTTGGACTTTGGGTTGGGTCGGCCGGTCCGCCATCAGGTGTGCACCGGTTTACTCATT
CCTTCTGTCGGTGATGCGCTCCTACCCTTAACTAGGTGGGTCGTGCCTCCGGCGTTGTTACTTTGAAGAAATTAGAGTGCTCAAAGCAAGCCTACGCTCT
GTATACATTAGCATGGGATAACATCATAGGTTTTCGTTCCTATTACGTGGCCTTCGGGATCGGAGTAATGATTAACAGGGACAGTCGGGGGCATTCGTAT
TTCACAATTAGAGGTGAAATTCTTGGATTTATGAAAGAACAACTGTGAAAGCATTTGCCAAGGATGTTTTCACTAATCAAAAACGAAAGTTGGGGGCTCG
AAGATGATCAGATACCGTCCTAGTCTCAACCATAAACGATGAATTCCTAGTAAGCGCGAGTCATCAGCTCGCGTTGACTACGTCCCTGCCCTTTGTACAC
ACTGCCCGTCGCTCCTACCGATTGAATGGTCCGGTGAAGTGTTAGGATCGTGGCGACGTGGGAAGTTCACTACCCGCGACGTCGCGAGAATTCCACTGAA
CCTTATCATTTAGAGGAAGGAGAAGTCGTAACAAGGTTTCTGTAGG