Detailed information on CNT3020784


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3020784

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MALKLVFSNFHCQPNYSRDKLTTIHCYRSN*

>peptide 2 (34 aa)
MSLQSYHEFTNNSSKTLKLKSLATHSVKQHIEQN*

>peptide 3 (33 aa)
MCADKHLKSAFYSLKLREFILDFTCLLVVFRLK*

>peptide 4 (31 aa)
MRKIRRKDQKIKTEQEYGEKEMKNSKWQNLG*

>peptide 5 (30 aa)
MLHYNVIIVVLHYMFKINFSIKDPMHYVCS*

>peptide 6 (40 aa)
MFMFWVPNICFHDMLHVIVHLGNTLGESYLLSILYTHPIP*

>peptide 7 (41 aa)
MSLRGPAIKLTVLVIYAFCSTTLTFYGSWCFVKETFCKVFT*

>peptide 8 (43 aa)
MNWKLYFIMIMMVDYVSDEYYVAVIVILFIMPCTLTDVDFWVH*

>peptide 9 (52 aa)
MDFLFRLPKTLDEVDEIWVIVDKLMKTTCFLPVKATYTLDKLAQMSIDKIVS*

>peptide 10 (76 aa)
MRRGSAFPAPRCYSASMLMRFYFSAATHHAFQQGCVFQLFFTIFLLGFDLLVVSSNFPRFNLKITSKQVKSNIKLP*

Sequence

>CNT3020784
GAAAGAACAACTTAAGTCTCTCACCCATAAACCCTCATAAAAGATTTCTCAACTTTCTTCCATAAACTTTCTATTGAGGTTTTCTTACATCATTTCAAGC
CAAGGATAAGAAAAATATAAGCACCTAAGAGGTAAGTAGCTTATCTCACCATCTCTTTAAGTGTTTTATGGTAGTGTGCCTTTGTTATGTTGCATTATAA
TGTTATTATTGTTGTGTTGCATTACATGTTTAAAATAAATTTCTCTATAAAGGACCCCATGCATTATGTATGCTCATGATTAACTTGAGATCAAGTTTTA
TTTGGGTATAGGTTATGCTTTTAGGGCTAGTAGGGTATGTATGGTTGGAGGGCTAGTAGGGTATATACAATAAAATAAGGAATAAAATAAAAATAAAAAA
ATAAATAAACGATCAAATAATATACACCTCAAATTAAGATCTACACATCAAAAAAAAAAAAAAATATATATATATATATATATAAATAAATAAACAATCA
AATAATATACACCTCAAATTAAGATCTATCTTCTAATGAATATTAAATAACAAAAACCGTCCTTTGGATCCCCGGCAACGGCGCCAAAAACTTGATGTGC
CACTTTTGTGTGTTATCCGCAAGTGTACGAGTCAAGTTATAATATAAAACGGTTAAGTCCGAGTATCGTTTCCACTAGAGATCCAATTGGGAAGGTTTAA
GTTATTTAGCTATTCTAGAGTTGAATCAATTTTATTTGAGGATTGAAATTCAATATTTCAATTTTGGGAAAAAGAAAAATCAAGCCAAGAAAGTATCAAA
GGGAGAATTGCAAGAGTCAAAGAAAGTTCTAGGGTTTCGAATCCTTGTTTGTTTCATCATGCAAAATTATAGATTTCATGGATTTGATTCTTATGCCTAA
GTCTAGAAACTTAATTCCAAGTTATCTTCTCTCAAAGACAACTCTTTCTCATGCAACTTGATTGATAGTTAATCTCTTAAAACCAATACAAAATTACATG
GCATTAAAACTAGTCTTTAGCAACTTTCATTGTCAACCTAACTACTCTCGTGATAAATTAACAACGATTCATTGTTATAGATCAAATTAAACATATAATC
TCTCGATTATACATCTAACCTAACATGTGAAGGTGGCCAATCTTCAAGAATTAAACACAATAACAATGAAAAGCATATTTATTTGAACAAAACCATGAGT
CTACAAAGTTATCATGAATTCACAAACAATTCATCAAAAACCCTAAAACTAAAGAGTTTAGCCACTCATAGCGTGAAGCAACATATTGAGCAAAACTAAT
CAAAGAAAGAGTGTAAAGAATAGGGAAACTCTACTGAAAAGAGGTTCTTGATTGAGGCAGCACCGTCACGAACTCCTTGGCTCTCGCGTCGGACTTTGAA
GGGCACCAAAACTATCTCGTACTCTTTTCCTCTTCCTTGCGGCTAACTCACTCTTGGAACTCTAGCTTAATTCTCACCTTTTTGGATCTTTCTTTTGTTC
TGCAACTTTTCTTGATTTTCTTGATTTTTCTCCCCCTCCTTTTGGCTGCTGAAAACCCCTAAATTTATAGGGTTTGGCTACCCAAAATTTGACCTAAAAT
ACAAACTTTTCGTTTTAATTAACGCTGGCGCCGCGGCGCTAGGGTTGCGGCCAAAAATAAGTTGCTCTTGGGTTTTTTAAGGATGCGTCGAGGCAGCGCC
TTCCCAGCGCCGCGTTGCTACTCTGCGTCCATGCTGATGCGTTTCTACTTCAGCGCCGCGACGCATCATGCGTTTCAACAAGGATGCGTTTTTCAGCTTT
TTTTCACCATATTCTTGCTCGGTTTTGATCTTTTAGTCGTTTCTTCTAATTTTCCTCGTTTTAACCTGAAAATCACTAGCAAACAAGTGAAATCTAATAT
AAAACTCCCTTAATTTGAGAGAATAATAAGCACTTTTCAAGTGCTTATCAACCTCTCTAGTCCAATCTTATGTTTATGTTAAAGTTGATGTTGGATGCGA
CTCTAGCTCTACTGACTGTATGACCCGCTAATCATCAGATGAGTTAGTTTCGCTTAAAGTCCACATCTTTCTATTAGGGCGGAATGTTAAAGGTTGATGT
TTGATGCAACTCTGATTCTACTGACTGCATGACCCGCTAATCATCAGATGAGTTGGTTTCGCTTAAGTCCACATCTTCCTATCAGGGTGAAGGAACTCAT
GTTGGAAGCATAACCGATTACCTCATGTTATGACATGTTTATGTTTTGGGTCCCAAACATATGTTTTCATGACATGTTGCATGTGATTGTGCATTTGGGC
AATACATTAGGTGAGAGCTACTTACTGAGTATATTATATACTCATCCTATTCCATAAACTTTGTAGGTGAGGGCACAGCATAGAAGACATGACGAGATGT
CACTCAGAGGGCCAGCCATCAAACTCACCGTTTTGGTCATATATGCATTTTGTTCCACTACGCTAACGTTTTATGGATCCTGGTGTTTTGTAAAAGAAAC
TTTTTGTAAAGTTTTTACTTAACTAATGGAAGTTTTGATGTTTACTTTAAAAATTTTTGACCAAAACTCAGCTCATGATAGAAAAGTTTAGGTATGCATG
ACGTAGCGGTCTGACCTTGTTATGTAAGGGTCAGGGCGTTACAGGGAGATAGCTCAGTTTGTGACAAGGTGTTTAATTTGTTAGTAAGTGAAACCTAAAC
ATCAGAAGCCAACAGGATTGTTGAATCCACTCCCTATTCCTGAGTGGAAGTAGGAGCACGTTACGATGGATTTTCTATTTAGATTGCCAAAGACTCTAGA
TGAAGTTGACGAAATTTGGGTGATTGTTGATAAACTGATGAAGACGACATGTTTTCTACCAGTTAAGGCAACCTATACACTGGATAAACTGGCACAGATG
TCTATAGATAAGATTGTGAGTTAATATGGAGTTCCAGTATCTATTGTATCAGATAGAGATCTGTGACATCTCGAATTTTCAGTTATTTTCTCCTTATTAA
GTACCCGTTTTTAATTGTTTAAACATGGAATTTTTTAGGTTAATAGGAAATTTAATGGAATTGGATAATTACTTGGTGGTGGAGTAAAGTTATTTTAAGG
AGCGGGGGAAAAAGGAAAAAAATAATAACAATAAGTAAAATATTATTTTTGGAATTGAGTTTATTTATTTAAGGAAAAGAAAGAGGAAAAGGGGGGGGAG
GGATAAAATAGGTTATTTAAATTAGTTAGGGTTCGGTATTAGCAAAAGGAAAGAGATTTAACTTTTGGTCATTAAATTGGTTGGCTTCTCGTTTTGCGTG
TAGTCAAAGAAAAGAAAAAAAAAAACCCCTTATTCTTCCTTCAACCTCACGCCGTCGCCGCTCTTCCCCCAACTTCTCCTTCTTCTGCTTTCATTATTCG
TCGTCGCCCAGCAACGTCGCTGACATCGTCTTGCTCAGGTGGATCTGGTTCTGTTGCTGTCGGGGATAAGTGTCGTCGGTTGCTCGATCCTGGAGGACCT
CCTTCGCCGTGGTATAGGCGTTGTCTCGCTCGGTTGCTTTCGCGAGGAAGGTCTCGCTTTCGCTCGAAGGGTCTTGATCTCGCTCGGGTGGTTTCCTCAG
GTAGGTCTTGCTTGTCTTCGCTGCGCTGCCACCTTCTAATTTCATATTTGGTTAGGTAAGACTTTATGGTTTCGGTTTAAACCACGTGTTGGGTGAGGTT
ACTTAGTTTGTTATGCGAAAACTTCGTTTAAACTTAAGTTGAAGAACCTAACTGGAATGAATCTACATTCTAGGTTTCAAGTGAAGGACTCCGAGTAACG
GATGGGCGTGGCTAGCTAGTTAGACATATCCCAAGGTAAGGAACTTACTACTGAGTCTATGTTGACGCCTATGGTTACCTATTGACTGAGTTATGGTTAC
TATATTGACTGGATTATTGCATTGACTGGTTATGATTATTGTGTCCACTAGAACGATGGTTATTTAACTTCTTACTATGAACTGGAAACTCTACTTTATT
ATGATAATGATGGTTGATTATGTTAGTGATGAGTACTATGTTGCAGTGATTGTTATCCTATTTATCATGCCCTGTACCCTTACTGATGTAGACTTTTGGG
TACACTAACTATGATTATGATTATGATTACGACAGGGTGTCCCTACCTATGTTTATATTTATGACTGTGACCTTCGGGATCAATGTGTGCTGATAAGCAC
TTGAAAAGTGCTTTCTATTCTCTCAAATTAAGGGAGTTTATATTAGATTTCACTTGTTTGCTAGTGGTTTTCAGGTTAAAATGAGAAAAATTAGAAGAAA
AGACCAAAAGATCAAAACCGAGCAAGAATACGGCGAAAAAGAGATGAAAAACTCAAAATGGCAAAATTTGGGATAGCGCCGCGGTGCTAAAACCCGAGCC
AACAATCCTGAACGCATCATAGCACCGCGGCGCTAAAACCCGAAAGCAACAATTCTGAATGCAGCCCTAGCGCCGCGGTGCTCTCCAACAGCGTCACGGC
GGCGTTTCAAAATTCTCAATAGCGCCGCGGCGCTAGCTTTCCATAAATGAAAAATAGACCAAAAGAGGCACAAGAAGGAGAAAATTGAGTGAGAGTTCAT
AAAAGAGTTCAAGGAGTGAGTTAGTTGCAAGGAAGAGGAAAAGAGTTCGAGATAGTCGTGGTGCCATTCGAATTCCAACGTGAGAGCCAAGAAGATCGTG
ACGATGCTACCTCAATCAAGAGCCTCTTTTCAGTAGAGTTCCCCTTTTTTTACACTTTTTCTTTGTTTATTTTTGTTTAAACATGTTGCTTCAAGCTATG
AGTGGCTAAACTCTTTAGTTTTAGGGTTTTGATGAATCGTTTATGAATGTATGTTTATATTGTAGAC