Detailed information on CNT30204924


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Expression of CNT30204924

Peptides detected in this lncRNA

>peptide 1 (67 aa)
AQGISEFKPTPTENRECCKNSYNVKKTLLVKFNTDAILEETLRPRVEAIGGTLEKVSLSGNHITPCIQ

>peptide 2 (29 aa)
LKEYRNSNQHQLRTVNVARTRIMSRKHSW*

Sequence

>CNT30204924
TGCTCAAGGAATATCGGAATTCAAACCAACACCAACTGAGAACCGTGAATGTTGCAAGAACTCGTATAATGTCAAGAAAACACTCCTGGTGAAGTTCAAT
ACTGATGCCATTCTTGAGGAGACTTTGAGGCCTCGTGTGGAAGCTATAGGTGGAACGCTTGAAAAAGTTTCATTGAGTGGTAACCACATCACACCATGCA
TCCAGG