Detailed information on CNT30182054


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8RU27|RGP2_SOLTU, E-value = 3e-61

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30264864Secale cerealeBrassica rapa27.8111.0785.7184forward
CNT30361540Secale cerealeSorghum bicolor26.4918.3586.2580forward
CNT30595951Secale cerealeOryza meridionalis35.4349.7783.18107forward

Expression of CNT30182054

Peptides detected in this lncRNA

>peptide 1 (45 aa)
GPMSSRSKARFMPHMGKREPLGMVMTASTYLLLRSRGLTSCVGAS*

>peptide 2 (99 aa)
RADELAVEGEVHAAHGEEGALGDGHDGVDVPAVALPRLDQLRGGVVVGDVEPEAERVAAHEVGALLVGVVQGVEEERRGGAEQVLDVLGQRVDVLPRGVL

Sequence

>CNT30182054
CGGGCCGATGAGCTCGCGGTCGAAGGCGAGGTTCATGCCGCACATGGGGAAGAGGGAGCCCTTGGGGATGGTCATGACGGCGTCGACGTACCTGCTGTTG
CGCTCCCGCGGCTTGACCAGCTGCGTGGGGGCGTCGTAGTCGGGGATGTTGAGCCAGAGGCTGAACGGGTAGCCGCGCACGAAGTCGGCGCCCTCCTGGT
AGGGGTCGTACAGGGTGTTGAAGAAGAGCGGCGTGGAGGGGCAGAGCAGGTTCTGGATGTGCTTGGCCAGCGCGTCGATGTCCTTCCCCGTGGGGTCCTT
GG