Detailed information on CNT30161234


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LPV3|R27A1_ARATH, E-value = 6e-15

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30641194Pistacia veraNymphaea colorata53.6513.7188125forward
CNT30531335Pistacia veraEucalyptus grandis27.0421.1485.7163forward
CNT30371729Pistacia veraArabidopsis thaliana81.5534.885.26190forward
CNT30287025Pistacia veraTriticum aestivum81.9734.7383.25191forward
CNT30553249Pistacia veraOryza glaberrima60.0925.5587.86140forward
CNT30451383Pistacia veraSaccharum spontaneum63.0926.4485.03147forward
CNT30227365Pistacia veraAnanas comosus63.5221.887.84148forward
CNT30650917Pistacia veraRosa chinensis82.8330.290.67193forward
CNT30362394Pistacia veraSorghum bicolor57.5120.7488.81134forward
CNT30496106Pistacia veraDigitaria exilis81.9727.2183.25191forward

Expression of CNT30161234

Peptides detected in this lncRNA

>peptide 1 (59 aa)
GACGNTSYPLYQNTPGGTCRRGSGGGACLRRFRDLRGVSGVSRFVRGRRSRGPSSCGFS*

>peptide 2 (76 aa)
RSLWKYLIPTLPKYPGWYLSKRIRWWCMPPAFPRPPGCFRCFPIRPWPALTWPLFLRFFLNLVVIFLGGLRIGVVDW

>peptide 3 (74 aa)
ELVEIPHTHFTKIPRVVLVEEDPVVVHASGVSATSGVFPVFPDSSVAGAHVAPLLAVFLESGRHFFGRSEDWGC*

Sequence

>CNT30161234
CGGAGCTTGTGGAAATACCTCATACCCACTTTACCAAAATACCCCGGGTGGTACTTGTCGAAGAGGATCCGGTGGTGGTGCATGCCTCCGGCGTTTCCGC
GACCTCCGGGGTGTTTCCGGTGTTTCCCGATTCGTCCGTGGCCGGCGCTCACGTGGCCCCTCTTCTTGCGGTTTTTCTTGAATCTGGTCGTCATTTTTTT
GGGAGGTCTGAGGATTGGGGTTGTTGATTGGAG