Detailed information on CNT30139307


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30253176Lolium perenneAvena sativa49.5857.3491.79414forward
CNT30150498Lolium perenneBrachypodium distachyon9.5828.079080forward

Expression of CNT30139307

Peptides detected in this lncRNA

>peptide 1 (98 aa)
MVPARTTTTCTPATSSTPCSPITTIPTCSTIATWGTTTTISTTSICTTTIGTGTICSICTISTSVHRATIPTTIARPKSSIASIGSAIASSTITISCAI

>peptide 2 (36 aa)
MCSFYTGLWAGSATKITLVPGYDLIEQNQKCSDASD*

>peptide 3 (32 aa)
MVLSHQYCYYHERLVQGFSNALRIETKEYNTA*

Sequence

>CNT30139307
GTGCCATAAAAAGACGTTTCATCACGTTCTTTTACACTCATCTTCCAAGACCATTTCGAGCACCATGAGCATTATCGAATGACTATACATAACCTACCAT
GTAATACGACTAGGGGATAACAATCAACTGGAAGCATAAAACCAAATCGTTCAAAGTTACCCCTACATATAAGCTCAAACTGGCAACAGCTTAATGTGTA
GACAATCTCTTACAGCACAAATATGGTTCTATCACACCAATACTGTTACTACCACGAAAGGCTAGTTCAAGGGTTTTCTAACGCTCTGCGTATAGAAACT
AAAGAATACAACACAGCTTAAATGTGTAGCTTCTACACCGGACTATGGGCAGGCTCAGCAACAAAGATAACACTTGTCCCTGGTTACGACTTAATTGAGC
AAAACCAAAAATGTTCTGATGCCTCCGATTAAGGTGACCAAGATGAATGCCGAACTTCTAGGAGATCTGATGATGACGCACCCGCTTATTGCATCCTAGA
AATAACTTGGGTGAGTTGGCACTTACTTCCCATACGGATGGTACCTGCTAGAACCACGACCACCTGCACTCCCGCCACCAGCAGCACCCCCTGCTCCCCC
ATAACTACCATACCCACCTGCAGCACCATAGCCACCTGGGGCACCACCACCACCATAAGCACCACCTCCATATGCACCACCACCATAGGCACCGGCACCA
TATGCTCCATATGCACCATAAGCACCTCCGTACATAGAGCCACCATACCCACCACCATAGCCAGACCCAAATCCAGCATTGCCTCCATAGGCAGCGCCAT
AGCCTCCTCTACCATAACCATATCCTGTGCTATCG