Detailed information on CNT30135358


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30135358

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MELELTGVAFIQAVLRMDVSPPCNQSAEAG

>peptide 2 (37 aa)
MRRLLRPPGGSEARRNERRGRRRRRPLGSNSGNWKYI*

>peptide 3 (69 aa)
MSTSSKDPVTVTRTRSVFTSGHLTSQQWATTENRARAHGAPGWSCYHGARAHRCRLHSGRSPHGRQPTL*

>peptide 4 (98 aa)
TARNPSLGAPSSVAADGIVRPHGNRDAATSPSSRRQRSSEKRTTGEAPPAATRKQFRELEVHINYMVTQDLDSSVISYFFQNMCSLSCSLEACSCQHI*

Sequence

>CNT30135358
CGACGGCCCGAAACCCTAGCCTAGGGGCACCCAGCTCCGTCGCGGCGGACGGAATCGTCAGGCCACACGGAAACAGAGATGCGGCGACTTCTCCGTCCTC
CCGGCGGCAGCGAAGCTCGGAGAAACGAACGACGGGGGAGGCGCCGCCGGCGGCCACTCGGAAGCAATTCAGGGAACTGGAAGTACATATAAATTACATG
GTTACTCAAGACTTGGACAGCTCTGTGATATCTTATTTCTTCCAAAATATGTGTTCCCTTTCTTGCAGTTTGGAAGCTTGTTCGTGTCAACACATTTAAA
GACAGTGGACTAAATATGTCTACTAGTAGTAAGGATCCAGTTACAGTTACAAGAACAAGATCAGTTTTCACCTCTGGCCATCTTACAAGCCAACAGTGGG
CTACTACTGAGAACCGGGCACGCGCACACGGAGCGCCAGGTTGGAGTTGCTACCATGGAGCTCGAGCTCACAGGTGTCGCCTTCATTCAGGCCGTTCTCC
GCATGGACGTCAGCCCACCCTGTAACCAATCCGCTGAAGCTGGG