Detailed information on CNT30132936


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676339Lolium perenneSetaria viridis9.6421.3686.92107forward
CNT3017870Lolium perenneZea mays12.3433.8382.48137forward
CNT30603977Lolium perenneOryza punctata9.125.1287.13101forward

Expression of CNT30132936

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MLHNLMCQLINTSAGIFNNLSHVSIDLCTGFVAYNGTDALNSK*

>peptide 2 (30 aa)
MEFPHVRERNLEELLMLPRHATRHVVAVLV*

>peptide 3 (57 aa)
MYHSLIISLFSTVIGIASKKWEMKEEASRQWEMEVEVSRHRKKLEEVARDEAGSSYS*

Sequence

>CNT30132936
GGGTGTGATGGTTGCTTAAGAATATCAATCTCCTGCCAATATGGAAATGAATAACATGTTGTTGAGTCAATTTAATAGGTAAGGCAAATACTATTACCAT
AGACAGAAAGATAACTAAGCTAGCTGACTTAAGAAACCAAGTAACCTGATTCAATTGTTTGAGTCGTTCTTTCGAATGTGGATCATCTGAAATAACTTGT
ACTTCCTTAATCGCGCAAAACTGCCCATTTTCACTGCATAATTGCTCACCACATAAGAGTTCTCACACAAATTTCTTTCTTTAGATATTTAGGCAACACC
CCCCAAGAGGCCAAGAAATTCAATCAATATCAACAATTCGGCATCAGGAAATTGGAGCAAAGAATAGCATGCTAAGTTCTTATCCATTAGTTATTTGTCT
TGAGATTTAAGAACTTAAGATGCTACATAATCTCATGTGTCAACTTATAAACACATCTGCTGGGATATTCAACAATTTATCTCATGTGTCGATTGATTTG
TGTACAGGTTTTGTAGCATATAATGGCACTGATGCATTGAACTCCAAATGATAATCAAATAATAAATAATGCAAAGACATGAAAAAAAAAACACCATACC
TGTTGAATCCAAGATAAACCTGGCCAAATGTACCACTCCCTAATAATTTCCCTTTTCTCCACTGTGATTGGAATTGCAAGCAAGAAGTGGGAGATGAAGG
AAGAGGCGAGCAGGCAGTGGGAGATGGAGGTAGAGGTGAGCAGGCACCGGAAGAAGCTGGAGGAAGTGGCAAGGGATGAGGCGGGCTCCTCATACAGTTG
ATCGTTTTCAACGGTGACCTTGGGCTAAATCCGAATTCTCTTGCATGTGCATTACTTATAGCGAAGTTATGGCCCTTTGGGCCAGGGGAAGGGCTTCCCG
TTCTTGAATCAAATATATCCTCAGACCACACCCTGCTACGCGAACTGGCTTCACTAGTCGAAGGGTCATCGCTGTGCGAATGGAGTTCCCTCACGTTAGA
GAAAGGAACCTCGAAGAACTTCTGATGCTCCCGCGGCATGCTACGAGACATGTAGTGGCTGTCCTTGTTTAGGATCATCGGTGAGTCGGATGGCGTATTT
GTTCCCTTGG