Detailed information on CNT3012358


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3012358

Peptides detected in this lncRNA

>peptide 1 (64 aa)
MQYCTIINWSPRHHLKFHNVAIKTNISFHNNEDYKILLMPSFIILKNSLKQSLSTYISHLNITL*

>peptide 2 (87 aa)
MFTFYLWFVFAEHPIFFIYRGQHFLFLFFSCSVCFGSRDLGIRRPSSCGVIQFLPLEYGLQARPSHLALCIILCETRARMPHSSLSN*

>peptide 3 (31 aa)
MVGCDDEVHTTLINRLRWRSDVHLLPLVRIR*

>peptide 4 (44 aa)
TSQPRNPKARTRRRHLHLPPRHVWFQRSATFLCVFFRDPFVFPW*

>peptide 5 (48 aa)
IPRNPETLKPALAAAICIYLLVMFGFRDPPLSSAFFFGILLSFHGRVR*

>peptide 6 (52 aa)
MDCSLSVLCRPSLPSDSKTSNLVTRSRKPFHVCGNGVPICQILGFYRYLHRS*

Sequence

>CNT3012358
ATACCTCGCAACCCCGAAACCCTAAAGCCCGCACTCGCCGCCGCCATCTGCATCTACCTCCTCGTCATGTTTGGTTTCAGAGATCCGCCACTTTCCTCTG
CGTTTTTTTTCGGGATCCTTTTGTCTTTCCATGGTAGGGTGCGATGACGAGGTACACACAACCCTGATCAATCGCCTCCGATGGCGATCTGATGTTCACC
TTTTACCTTTGGTTCGTATTCGCTGAGCATCCGATCTTCTTCATCTATCGAGGCCAGCATTTTTTGTTTCTTTTTTTTTCTTGCTCGGTTTGCTTTGGAT
CGAGGGACCTGGGGATCCGCCGCCCTTCTTCGTGCGGCGTCATCCAGTTTTTACCCCTCGAATACGGCTTGCAGGCGCGTCCTAGCCATCTCGCTCTCTG
CATAATCCTCTGCGAGACCCGGGCTCGTATGCCACATTCGTCGTTGTCAAACTAAACAAAAAAAATAGGCTTTTGTCGCGAAGATCCCAGCAGAGAGGTG
CGCTGATGCCTCCCTAACAATCATAATCTTCGCAGAGAAACGCTCATGATCCGTGGTTTCGTGGATGTGTGATTTGGATTTTTGTTCCATTACATCTGTT
TCCACGGCGACATTTTCATGATTACTGCAGCGAACTGAACGAGGGACCTATGGATGGACTGCTCTTTGTCCGTGTTGTGCCGTCCAAGTTTGCCTTCGGA
TAGTAAAACCAGCAATCTGGTCACGAGATCTCGCAAGCCTTTTCATGTTTGTGGGAATGGTGTGCCAATTTGCCAAATTTTGGGTTTCTATCGTTATCTT
CATAGGTCGTAATTTTGCCAGGATATAGCGCCGGAACCCCATACTGAGGTCGTCGTTATTGCAGTCATAAGCGACGATGAAACTTTGAACAGACCAGAAT
GTTCTTGCAGTCACAAGTGGTTGTCTAAATTTGGATATTGAACAGAATTACTTCCAGTTGAACCTACCGCTTCAACAATTGGCATACTTGCCTGAGTGGC
TAACGATCCATGCAATACTGCACTATTATTAATTGGAGCCCGAGACACCACCTCAAATTTCATAACGTCGCTATAAAAACAAATATTAGTTTTCACAATA
ATGAAGACTATAAAATACTTTTAATGCCTAGTTTTATTATTCTAAAAAATAGTTTAAAACAATCTCTAAGTACATATATAAGTCACCTAAATATAACATT
ATGAAAGACAATTTGAAATACTTTTAG