Detailed information on CNT30117963


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SS03|DIR21_ARATH, E-value = 2e-32

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30524593Oryza nivaraSetaria italica26.9937.9482.24214forward
CNT30106803Oryza nivaraOryza longistaminata17.7864.0990.07141forward

Expression of CNT30117963

Peptides detected in this lncRNA

>peptide 1 (84 aa)
MATTAPKKVEEPFVDAACATLIAVGFVPPTTSWKYTLNLVIPAAPSSAARATAAAAHRSTARTRKAGDAAMAGAEQDEEEGGGS*

>peptide 2 (31 aa)
MRNLPEPPTMLISLTAESTSFRPNVFWSANV*

>peptide 3 (35 aa)
MRRREEVARASERSSTYEARNGDWRVVGVGDDEIQ*

Sequence

>CNT30117963
TCGCCCTCCAATTAGATCAACTGAAACCCAATCAGAAAATCAACCAAAGATGATGATAAACAATATTTAATGCACTCGGAATGAAAAGACTAATCAATTA
ATTAAGCACGTACAAACACGGCGCTCAATAATTGCCAGTAGCGTTTTAATTTGCAGGTAGATCTCTCTTCTCTACGCCTTGACGAAGACGGTGTACTCGA
CGATGGTCTCGCCGGAGTTGGCGCCGGAGTCGACGGTGCGGGCCTCGACGTAGCCCCTCGCCATGCGGAACTTGCCGGAGCCGCCGACGATGCTCATCTC
CCTCACCGCCGAGAGCACCTCGTTCCGGCCGAACGTCTTCTGGTCGGCGAACGTGTAGCTCCCCTGGGCGCGCCCCACCTCCGACGACGACGACGCCGCG
TCGGTCGTCAGCGGGTCGTCGATGGCCACCACGGCGCCGAAGAAGGTGGAGGAGCCGTTCGTCGACGCCGCCTGCGCCACCCTGATCGCCGTCGGCTTCG
TCCCGCCCACCACGTCGTGGAAGTACACCTTGAACTTGGTCATCCCCGCCGCGCCGTCGTCCGCCGCCCGCGCCACCGCCGCCGCCGCGCACAGAAGCAC
GGCAAGAACGAGGAAAGCCGGTGACGCCGCCATGGCCGGAGCTGAGCAAGATGAGGAGGAGGGAGGAGGTAGCTAGAGCTAGTGAGAGATCGAGTACTTA
TGAAGCAAGAAATGGAGATTGGAGAGTGGTTGGTGTAGGAGATGATGAAATTCAGTGAGATAGAGTGGATGTGGCAGAGCAAGCATATGCAGG