Detailed information on CNT30117338


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0J8M2|FER1_ORYSJ, E-value = 2e-55

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695489Oryza nivaraOryza sativa94.7310099.73737forward
CNT30596741Oryza nivaraOryza meridionalis97.0493.6791.92755forward
CNT30370929Oryza nivaraOryza glumipatula96.5397.9199.73751forward
CNT30103152Oryza nivaraOryza rufipogon85.0979.3899.7662forward

Expression of CNT30117338

Peptides detected in this lncRNA

>peptide 1 (47 aa)
IYSLLINCSFKYMEYVFDSSIYDTVMHAYMTPKCDMDMIKQVQQNVH*

>peptide 2 (72 aa)
MYTSSGTCSSTSPSGVISFTLYVACIRSLSPSLLLAGSTDTRAGAGAVATRRDIGNRTWLLSAVAAMAAIAN*

Sequence

>CNT30117338
GATATATAGCTTATTAATTAACTGTTCTTTCAAATACATGGAGTACGTATTTGACAGTAGTATATATGACACAGTAATGCATGCATATATGACACCAAAA
TGTGATATGGATATGATTAAGCAGGTGCAGCAAAACGTACATTAATTAAACAACAACAATTAACCCTCGGGCACGCCTGTGTTTTGTTATCTCGCTCAAC
GTATACGTACGTAATACTTTGCTTGCATAGCATAGGGACGACGACATTATATTCTTAATTGATAAACTCAAGAACGCATGGAGATGGATTGAGAGATTTA
TAAATATGGAGCTTGCTTGATTGATTAGATGAGGTCGTCCTCCTTGTGGGTCTCGATGACGACGTCGGACTTGGGGTAGGCGTGGCAGGTGAGGACCCAG
CCGGCGGCAACCTGGTCGTCGTCGAGGAAGCTCTGGTCGGACTGGTCGATCCCTTCCTCCTCCGCCTGGTCCAGGATGTACACGTCGTCCGGCACCTGCA
GCTCCACCTCGCCGTCCGGTGTGATCAGCTTCACGTTGTACGTCGCCTGCATCCGCAGCCTGTCTCCCAGCTTGTTGCTCGCCGGCAGCACCGACACGCG
CGCCGGCGCCGGCGCCGTCGCCACCCGCAGGGACATCGGCAACCGGACCTGGCTGCTCAGTGCCGTCGCCGCCATGGCTGCTATAGCTAATTAAGCTAGC
TAGCTGCTGCTGCTAGGTAAGGTAGACGAGGAGGAGAGGAGTGAGCTAGCAAGAATGTGAGCGTGAGGTTGAAGGAGG