Detailed information on CNT30116717


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0DG05|PSAH_ORYSJ, E-value = 1e-46

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693422Oryza nivaraOryza sativa56.5765.59100465forward
CNT30673198Oryza nivaraSetaria viridis13.7549.5695.58113forward
CNT30520893Oryza nivaraSetaria italica15.6935.3494.57129forward
CNT30532753Oryza nivaraEucalyptus grandis12.5341.5383.5103forward
CNT30178026Oryza nivaraSecale cereale16.1823.8482.71133forward
CNT30285918Oryza nivaraTriticum aestivum13.1422.9889.81108forward
CNT30384456Oryza nivaraTriticum turgidum13.1420.1989.81108forward
CNT30591852Oryza nivaraMusa acuminata11.6823.0291.6796forward
CNT30435366Oryza nivaraAegilops tauschii13.1423.7490.74108forward
CNT30240454Oryza nivaraAvena sativa13.1430.6894.44108forward
CNT30655703Oryza nivaraTriticum dicoccoides13.1430.0890.74108forward
CNT30131217Oryza nivaraLolium perenne13.1421.6494.44108forward
CNT30679604Oryza nivaraTriticum urartu13.1432.1490.74108forward
CNT30370255Oryza nivaraOryza glumipatula63.1481.48100519forward
CNT30704201Oryza nivaraPrunus avium10.4633.284.8886forward
CNT30149479Oryza nivaraBrachypodium distachyon15.3332.7388.1126forward
CNT30101773Oryza nivaraOryza rufipogon81.6381.4398.96671forward
CNT30576447Oryza nivaraOryza barthii32.689.3399.63268forward
CNT30496573Oryza nivaraDigitaria exilis16.552595.59136forward
CNT30604129Oryza nivaraOryza punctata27.8636.5294.32229forward

Expression of CNT30116717

Peptides detected in this lncRNA

>peptide 1 (78 aa)
MSVLKIEHGISGLKPHTPLATAISSASLLLLAYSSYVPAGGAAERPGRRPDGELPAGDGAAGEGRHCCGEFAGGRKAE*

>peptide 2 (44 aa)
MYLRVVRQSARGDGLTASFLPEMELPARDAIAAVNSREDAKLSR*

>peptide 3 (36 aa)
QHRIGSFTTYIAIGIVQLYQHHKQGELIHGDPAMGD*

>peptide 4 (33 aa)
MAIRPWGTSSTVQRICMDGSDQEEGEAETRNLI*

Sequence

>CNT30116717
TGCAGCATCGAATTGGATCCTTTACAACTTATATAGCCATAGGAATAGTACAATTATATCAACATCATAAACAGGGGGAATTAATCCATGGCGATCCGGC
CATGGGGGACTAGCAGTACAGTACAGAGGATTTGCATGGATGGATCGGATCAAGAAGAAGGTGAGGCAGAGACGAGGAATTTAATTTAGATCTTGCCGCG
TGGGCCGGGCGTCGGCGGCAGCTGCGGGCCCTTCTTGATCGGAAGCAGGAACTTGAGCAGGAGCCCCCTCTTGGTGAAGGGCCCCGCGAACGTCTCGAAG
AACTTGCTCTGCATCGATCACCCACACGAATTATTCAGTAAATTAATCATCGAGCTAAGTATATATTTTAGTCAGGTAATACTAACCTGGAGAGGGTTGT
ACGGCGACGGCGCGTCGGAGCCGTACAGGTCCCACTGCCCGGTGGTGTTGCCGATGTCCTCGAGGTCGAAGTAGACGCTCTTCTCGCCGTACTTGGCCAC
CACGGCGGCGCGCGGCCTGTAGCAAGAAGAAATTATGAGCGTGTTAAAAATTGAACACGGGATCTCGGGATTGAAACCACATACACCTCTTGCCACTGCA
ATATCAAGTGCATCTCTACTGTTACTCGCGTACTCCTCGTATGTACCTGCGGGTGGTGCGGCAGAGCGCCCGGGGCGACGGCCTGACGGCGAGCTTCCTG
CCGGAGATGGAGCTGCCGGCGAGGGACGCCATTGCTGCGGTGAATTCGCGGGAGGACGCAAAGCTGAGTAGATAGATGGATAGATAGCCGGTGTACTATC
TGCGGCGGCGGCTACACGTTCG