Detailed information on CNT30116540


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552499Oryza nivaraOryza glaberrima10089.3299.15937forward
CNT30595723Oryza nivaraOryza meridionalis57.6380.9697.59540forward
CNT30100316Oryza nivaraOryza rufipogon10095.0399.79937forward
CNT30575214Oryza nivaraOryza barthii10083.6698.83937forward

Expression of CNT30116540

Peptides detected in this lncRNA

>peptide 1 (28 aa)
MLEHIVLKLVYLYVSCDIYWGKHNKLSGY

>peptide 2 (45 aa)
RRRFLTPVAESKLIRLVPPSRSPLPERPSRSSICSTYWPLPVLCS*

>peptide 3 (37 aa)
MIVMTHNLDLQLTVSIFSSRNIGDIMAGAAWSQSPTP*

>peptide 4 (71 aa)
ASPVSHACCRVQVDPIGSSVEVAPAREAKPIQHLLHLLAPPRSLLLTPSEINHRPPATAPAPCCSHDCDDT*

Sequence

>CNT30116540
CGCGTCGCCGGTTTCTCACGCCTGTTGCCGAGTCCAAGTTGATCCGATTGGTTCCTCCGTCGAGGTCGCCCCTGCCAGAGAGGCCAAGCCGATCCAGCAT
CTGCTCCACCTACTGGCCCCTCCCCGTTCTCTGCTCCTGACACCGTCGGAAATCAACCACAGGCCACCAGCAACTGCACCTGCACCCTGTTGCTCGCATG
ATTGTGATGACACATAATCTCGATCTGCAACTCACTGTCTCCATTTTCTCAAGCCGGAACATTGGGGATATTATGGCAGGAGCAGCGTGGAGTCAAAGCC
CTACTCCGTAGAGGGCTCGAGGCTGCGCGGATCGCTTCCTCTCTTTGAACACAGCTGGGGTGTGCGACATGGCTGTGGTGGAGGATCTGCCCCCACCCAG
GTTGAACATGGTGATTTCAGACATTTATCAATGATGGATTATCTGCTTGCCTATTCTTTCTGTTACATCAGTTGTGGGATGTTTTTCTGTTAAATTAATC
TAGGTTGCTCTCTTGATCTGGTCTAGACAGATCCTAAGCAAAGGTTGCAATAAGGAAAACAAAAGGAAAAGCTCAAAATATCCATGTCAACTTGAAGATA
TTGTGGATTGCAGATTGTGAGGGTTACATTTGAAGTTATTGTGGATGACACGAATCAATTGTGTAGATACTTGTGTTATTTTCTCTTACTTAGTGGAGTT
CTCTTGAATGCATCTGAAGACAACTCTTTTGCTTTGAGCCTTTCAAGTGTTTGTTAAGTTGTGGAAAATTGTATCCATTTTGTAATGTTGGCTACTTTGC
ACCTCCACAACAAGTGTCCAAGAGGGGGTAACCAAAATAGGCTAGATCATGTTAGAACATATTGTTCTTAAACTTGTGTATTTGTATGTTTCATGCGACA
TTTATTGGGGAAAACACAATAAACTATCAGGGTATTC