Detailed information on CNT30116476


BLAST search results

BLAST vs Swiss-Prot:
sp|O65660|PLAT1_ARATH, E-value = 3e-41

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30524143Oryza nivaraSetaria italica34.3241.5188.64220forward
CNT30553468Oryza nivaraOryza glaberrima45.7159.0791.13293forward
CNT30442037Oryza nivaraAegilops tauschii13.5727.1989.6687forward
CNT30243815Oryza nivaraAvena sativa16.5435.5793.4106forward
CNT30463851Oryza nivaraSaccharum spontaneum32.6135.2488.04209forward
CNT30596095Oryza nivaraOryza meridionalis20.950.19100134forward
CNT30108589Oryza nivaraOryza longistaminata49.9258.0891.56320forward
CNT30101300Oryza nivaraOryza rufipogon53.8247.78100345forward

Expression of CNT30116476

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MRPPHRCRSRIRTPEPSAPSSVTPITESVPPFQIVPVRTYIVYTHLFSGSDDASATVIPSAA

>peptide 2 (56 aa)
MHDSTSSRAVDHIRVRYIITRESKENLRFIYSTVTLGSSASAAAASLALLQLSTTA*

Sequence

>CNT30116476
TCGTCCGACCGATCCAACGCTGGTTTCATCTTATTACCCTCTTAAAATCGTATAATTATTTTAGCATCCTCCCCTCAATGTAAAAAAAAGGATCAATCGC
TGCAATGCACGACAGCACGAGCAGTCGAGCAGTAGACCACATACGCGTAAGGTACATAATTACACGGGAATCCAAAGAGAATCTACGATTTATTTACAGC
ACGGTGACCCTCGGCTCGTCGGCGTCGGCGGCGGCGGCGTCCTTGGCCTTGTTGCAGTTGTCGACGACGGCGTAGAGGCGGTAGGGCGATGCGTCGGTGG
CGAGCCACTGCTCGACGGTGAAGAGCTGCTGCGCGCAGCCGAGGTGGGGACCCGTGACGGTGAGGTTCATCCGGCACGGCGCCTGGCGCATGCAGGGGCC
GCGGCCGCTGAAGATGTCGAGGTTGCCGCGTTCGTAGTAGTCGTGGCCGTCGCCCATGAGGCCGCCCCACCGCTGCAGGTCGCGGATCCGCACCCCGGAG
CCGTCGGCGCCCAGCAGCGTCACGCCGATCACCGAGTCCGTCCCGCCCTTCCAGATCGTCCCCGTCCGCACGTATATCGTGTACACGCACTTGTTCTCCG
GGTCCGACGACGCCTCCGCCACCGTGATCCCCTCAGCCGCC