Detailed information on CNT30103816


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30103816

Peptides detected in this lncRNA

>peptide 1 (30 aa)
QSGTTMSTVKLKRADTYKQELRACFFSDLS*

>peptide 2 (55 aa)
MAATKRMAYSISAVFMLLLIISSTFSSCYAGKHRSQFLTQKFTVIQTNCYVCCLI*

>peptide 3 (39 aa)
MKTWLLLHGCKQLRGSREEHESLNNCVYRTVPDETSNVLL

>peptide 4 (31 aa)
MMIFLFLKKENKIARMVAYDASIVLHLQLKI*

>peptide 5 (57 aa)
MKDREAIIQRHREECKKTCRERHTYCPPEMPCCCMKNAPASSPSSVKNESGDGLVIN*

Sequence

>CNT30103816
GCAAAGCGGCACAACAATGAGCACAGTGAAACTGAAGAGGGCAGATACATACAAACAAGAGCTCAGAGCTTGTTTCTTCAGTGATCTCTCCTAATGGCAG
CTACCAAGAGGATGGCTTACTCCATCTCGGCGGTTTTCATGCTTCTTTTGATCATCTCTTCCACCTTCTCATCCTGCTACGCAGGCAAGCATCGATCCCA
ATTCCTCACCCAGAAATTTACTGTCATTCAGACTAATTGCTATGTGTGTTGTTTGATTTGAGTGGTTCATGATGATCTTTCTTTTCTTGAAAAAAGAAAA
CAAAATTGCGCGAATGGTGGCTTATGATGCTTCAATTGTGTTGCATTTGCAGCTAAAGATATGAAGGACCGAGAAGCAATAATACAGCGCCATCGCGAAG
AGTGTAAGAAAACATGCAGAGAACGTCATACTTACTGCCCGCCTGAGATGCCATGCTGCTGCATGAAGAACGCCCCGGCATCATCTCCCAGTAGTGTCAA
GAATGAAAGCGGCGATGGGCTTGTAATTAATTAATTAAATTGATTGATCATCTCCCATCCAAATTTGTAACGGATCGATTTGTTAGTTTGATGCTATCTC
AATGAATAAACATTCATGATTTTGTTATATTATGAAAACATGGTTATTACTCCATGGTTGCAAACAATTAAGGGGCAGCAGAGAAGAGCATGAAAGTCTG
AATAACTGTGTGTACCGTACTGTACCTGACGAAACAAGCAACGTTTTATTGCC