Detailed information on CNT30103130


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554565Oryza rufipogonOryza glaberrima77.1274.5599.391793forward
CNT30106321Oryza rufipogonOryza longistaminata29.9457.198.42696forward
CNT30577533Oryza rufipogonOryza barthii99.6699.8399.142317forward
CNT30117498Oryza rufipogonOryza nivara77.5574.9499.331803forward

Expression of CNT30103130

Peptides detected in this lncRNA

>peptide 1 (49 aa)
GSHVSALSMVLSLKTKGIGKTFALAACSVLVYKELSEKLELVIHTLSML*

>peptide 2 (42 aa)
GAAMSPHCLWFFLSRQKELGRPLLLLPAVFWCIRSYLRSWSW*

>peptide 3 (37 aa)
MIYKFCSSTSSEHLLKLCTIAIFLFTTDEFFKGGQEC*

>peptide 4 (40 aa)
MRQVYCTRKEVLTYTCSRTIYSVVCPAQSPTSSCSLSMLY*

>peptide 5 (32 aa)
GQPCLRTVYGSFSQDKRNWEDLCSCCLQCFGV*

>peptide 6 (42 aa)
MVVVAIWNCCQNYQVNNPCLIITRSDTSERSSTQMQQVNQWS*

Sequence

>CNT30103130
GGGGCAGCCATGTCTCCGCACTGTCTATGGTTCTTTCTCTCAAGACAAAAGGAATTGGGAAGACCTTTGCTCTTGCTGCCTGCAGTGTTTTGGTGTATAA
GGAGTTATCTGAGAAGTTGGAGTTGGTAATTCATACACTTAGTATGCTTTGATGTGAGAATCAAAGGGTGCAAGCCAAGGTCGCCATTGCAAATCGTGGT
GTGAAAGGAAGAGCTGAATAAACCAGCTGTTAGCTTGGAGGAAAACGTGGGGCAGCTATGGTCTTGGAAGCTAGCTGATGGTGAAACATTACTTGTGAGA
TCAATCGAAATATTTAACAGGAAAGCTGGCGTTTCTTTTTTATGAAATGATTATCATCCACAAAGCATGGTGGTAGTTGCCATTTGGAACTGCTGTCAGA
ATTACCAAGTCAATAACCCATGCTTGATTATTACAAGAAGTGATACCAGTGAAAGATCAAGTACACAAATGCAGCAGGTAAATCAGTGGTCATAGGATCA
TATCGAGCCAGGAACAAGAACATTTCAAGAAAGGCATGCATTCATATTTCTTAATTTTTTTTTGTTTCCTGGCTATCATAACTTTTGACATAGCTTGCTC
CATTGAATGGTAATCTCGTGTTAGAAAGTACTCCCTCCTTCCACTTATGGAAGGAGGGTGTATAGAAGCACTGTAACTATAGTTTGTCATTGCTGATGAG
ACAAGTATATTGCACTAGAAAAGAAGTACTGACCTATACATGTTCCAGAACCATTTACTCCGTCGTTTGTCCTGCTCAATCACCCACCAGTAGCTGCAGT
CTAAGCATGTTATATTAAAGTAACGAGAGAGAAACAAAGCAAAAAAGAAATACTCAAGTTGTTTTAGTTAACATCCTTACATTGCAAGTTGCGTGACGAT
ACCACATATGCTACTTGCCTACTCCAATAAGACTGACTCCTTAAAGATGATTTCATAGTGAAAATTGACAGAACAATATTGTAGTCCATATGGCTCTGAA
TCTTCCCATTGTTCTTTTCATTTTGTAAGAACAAAAGGTTGCTGTATATTCAATTAGTAAGCAGCTCAACTAGAATCCAATATTTCATTTTTTTCCCACA
CTTAATTTCATTGTATAATCGTTATTTTATACTTTTCTTGTTTATTGCATGATATACAAGTTTTGTTCATCGACATCTAGCGAGCATTTGCTAAAACTAT
GCACAATTGCCATTTTCCTATTTACTACTGACGAGTTCTTTAAAGGGGGCCAAGAATGCTAAATATGGTTATGAGAAGGAAAAGAGAGTGATCCATGGAA
CATAGCTTGGTAGGCTGAATCCAAAGAATAGGAGACATTAGATGTTCATTTTTAAAAGAAAGGAGCTTGAAGCTGAAATGTTCATACTTATTGCCAGATT
CCCATATATCCCATGACGACTGCAGTAGGCAAGCCACCATAGAATCTTCTTGATCCATGCCATTGCTTAAAGGCCTCAAAGACAAACGTGTTCTCCAGAT
TCTTCTTGCTGACTATAGCTCACCAAATTTGGGTCTATGATGAATGATTGAATTCTCCAACCAATTAAGAGCTTCTAGTAGTTAAATTAAACAACTCATC
AAGGTACTGACTAATGTTCAACTCACTCATTGACAAAGGCTCAAGGCATTTGGTAGTAGTTTGCTGTGATGTTTGGTTAGCTAACCTTTCCTAGCTACAA
GATACTAATCAAGCATCAATATATTAACCATTGGGTTCAATGTGTCTCCATCAGACGAACCAACGAGCGCCTATGCTGCCGTTGAATCACTATCGCTGAT
GCAAGCTATAAGCTACTTGCCCCCAAAATAATGGAGTATCAGCTGTGATATTGCCGCCCGTCCGAAAAAAGATACAAAATTTTCCAACTACCATGGTTGT
TGATACAAGGAAACAAAGGGCCTGTTTGGGGAGCTTCTAGCTGCTGCAGCTTCTCCCATAATCAGAAGCTCCCCCAAACAGTCCAGCTTTTGGTCCAGAT
TCTGAGAAGCTGTAGTTGTAAAATCCAGGAAATGAACTAGAAGCCAGAAGCTGGAAAACCCAGCTTTTCCAGATTCTGAGAAGCTGGCTACCAACCAGCT
GCTTCTCAGAATCTTAAGCTCCCCCAAACTCTGGCTATAGTTGGACTTGAAAACACGGGCTCTGGCCTCTGGCAATAAAACAGTCTGTAGAAACTTTTGA
AGATTCTCAAGAAGTTATGAGAAGTGGGGAAGGTGATATTGCACAATTATGTAAAATTTGAAACGCGGATTTGATTTCATCTGTAAGATAAAAAAAATTC
CTTGCCTCGCCAGAGAAAATGAGTT