Detailed information on CNT30102551


BLAST search results

BLAST vs Swiss-Prot:
sp|Q07473|CB4A_ARATH, E-value = 5e-37

BLAST vs NONCODE: nothing found

Expression of CNT30102551

Peptides detected in this lncRNA

>peptide 1 (67 aa)
NFININTCQVKSMQCAYVHSQSHSLSQIPRSIDRCTSGCINSSSWVFLYYKSPPCKSPLTTNPALLI*

>peptide 2 (61 aa)
MVVWSGSLRWVAQLLRGPLPVAAACTAKPRKATMARRACLISASCSRSFFSGSDANPSGSK*

>peptide 3 (37 aa)
MQVAINHQPSSPNLSSNQQKDDLSSLHTLPARSSSQN*

>peptide 4 (42 aa)
MCIHSHTHLVKYQDRSIDVQVDALIHHLGCSYITNHHHASRH*

>peptide 5 (42 aa)
MTSPLSIPSQLARHHKTKPRARTHTNASIPFELRAKELKLRG*

Sequence

>CNT30102551
TAACTTTATTAATATCAATACATGTCAGGTAAAGTCTATGCAGTGTGCATATGTGCATTCACAGTCACACTCACTTAGTCAAATACCAAGATCGATCGAT
CGATGTACAAGTGGATGCATTAATTCATCATCTTGGGTGTTCTTATATTACAAATCACCACCATGCAAGTCGCCATTAACCACCAACCCAGCTCTCCTAA
TTTAAGTAGTAATCAACAAAAGGATGACCTCTCCTCTCTCCATACCCTCCCAGCTCGCTCGTCATCACAAAACTAAACCGCGCGCGCGAACGCACACCAA
CGCATCGATCCCGTTTGAATTGCGCGCGAAAGAGCTTAAATTAAGAGGATGAGGAGAAGGTGTCGAAGATGGTGGTGTGGAGCGGGTCGCTGAGGTGGGT
GGCCCAGTTGTTGAGGGGCCCCTTGCCGGTGGCGGCGGCCTGCACGGCGAAGCCGAGGAAGGCGACCATGGCGAGGCGGGCGTGCTTGATCTCCGCCAGC
TGCAGCCGCTCCTTCTTCTCCGGGTCCGACGCCAACCCGAGCGGGTCGAAGTAGGACCCCCCCGGGTACGACGACCCATCCACCAGCTCCACCTGAAAAA
CACCATCGGACCATTCCTACGTCAGTGTCATCATCCTCGTCCGCGGCGCCGGCGATACGTAGTAACCAGGGTTTTAAATCTTTAGCTATAACTATTTAAA
AAAAGATGTAGCAATTTGTTCTCATGTACAATTTAGTCATAGCTGCCACTATTTTGAGAGGCTAAACGCTAAATGTTTTAGCCCGCTAGCTATTTGAAAC
AATGGTAGTGAGAAACGCCCAGAGGTTTTTCGGCTATCCCCACGGGCTAGACGACCTGGATTTGAAGCCTTACTCTTTCTAATTATTTGATATAATAGGT
CATTTTTTAATATTTGCTTTTTAAAA