Detailed information on CNT30102172


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000920, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694227Oryza rufipogonOryza sativa71.87100.2499.032877forward

Expression of CNT30102172

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MPNDLQWAAKSSQPFKKLKITTWHFLTFKVVFESPEDEGCV*

>peptide 2 (48 aa)
MVENKENVLEWLRLTQTVNSQQLQMPTVLATCTYYLRPSVHEQMSRII*

>peptide 3 (55 aa)
MPLDWVSATCKCKFSGINESKNVFYESEKISSIQLLASQQTEKYQTWIYTDTIQP*

>peptide 4 (34 aa)
MKELKPYNQFHSKLQQVHGFSSKDQIGFSLLRQI*

>peptide 5 (36 aa)
MAQINLNGNSNSSECPWFRQHVSTPSVHFVHEQNDE*

>peptide 6 (30 aa)
MGIRTLRPLGGLIVGKLWEGIPAKPLLTMA*

>peptide 7 (30 aa)
MISNGQPNHHSHSRNKKITNNEICIHRSML*

>peptide 8 (31 aa)
MAQVNPNCQFPTVTNAHGSGNMYILPPSLST*

>peptide 9 (34 aa)
MSCSKICLEHITKEPRRCRMISNGQQNHHSHSRN*

>peptide 10 (40 aa)
QCCATAVACTMQQYSRIVDQMSAIVDQMSDALLPINTEGI*

>peptide 11 (45 aa)
MHPLEISIENSNGWYLQWVNPFCSKSSQENKMMQRVCANSVEYRK*

>peptide 12 (42 aa)
MLISAKVDRHRPLCSLRTIRSTLPQIQHMLMRSPTLRASIIV*

>peptide 13 (56 aa)
MKGRAIRLIYKARQITITSQILHWQIVHCQNHNAGCWEKTTTIKQNKKKSAGKGRR*

>peptide 14 (50 aa)
MKRKRNCSQCEEYKCLRNTTASSTFIGLSFAFDQSNNPTPTIPYHQTYQF*

>peptide 15 (54 aa)
MLKAFYPVIIIMRIQMVGTSNLHESFLFEVCQENKTMRCVCIISVNTNTENKRN*

Sequence

>CNT30102172
CAATGCTGTGCCACAGCAGTGGCTTGTACAATGCAGCAGTACAGCAGAATAGTTGATCAAATGAGTGCAATAGTGGATCAAATGAGTGATGCACTTTTAC
CGATAAACACTGAAGGAATATGATAGCGATAAGATAACAGATCCACTATATAGTGTCACCCATGAAAGAGTTGAAACCCTATAATCAGTTCCACAGTAAA
CTCCAACAAGTGCACGGATTTAGCAGCAAAGATCAAATAGGCTTTTCACTCTTAAGGCAAATATGAAGGGTAGAGCTATCAGATTAATATACAAGGCACG
TCAGATCACTATTACATCACAAATATTGCATTGGCAAATAGTTCACTGCCAAAACCATAATGCCGGTTGTTGGGAGAAGACAACAACAATAAAACAAAAC
AAGAAAAAAAGTGCTGGTAAAGGCCGAAGATAAATAATACATAAAAGGAAGGCTTATTTTGTTCTTTGGAACTATGTATATACAAGATGGTGGCCTTGTT
TGTAACCTGTCTAAGTAGGGAAATCAGCACAGACATGTGACAATGCTCAAAGCATTTTATCCCGTGATAATTATTATGAGGATTCAGATGGTTGGTACCT
CCAATTTGCATGAATCCTTTCTGTTCGAAGTCTGCCAGGAAAACAAAACAATGCGATGTGTATGTATAATAAGCGTCAATACAAATACAGAGAATAAAAG
AAACTAAAACTTGCAAACTATCAAAATAAGAGGGGAGATTTTTGCCTTTCGCCACGGACTTGTTACATCATCTCATACATGCCACTTGATTGGGTCAGCG
CAACATGTAAGTGCAAATTCAGTGGCATAAATGAAAGTAAAAATGTGTTTTATGAATCCGAAAAAATCAGTTCTATACAATTATTAGCTTCTCAGCAAAC
AGAAAAATACCAGACATGGATCTATACAGATACAATACAACCATAAGAAACTAAGGACTGTTTTGGGCAAAACATGGTTGAAAACAAAGAAAATGTACTA
GAATGGCTCAGGTTAACCCAAACTGTCAATTCCCAACAGTTACAAATGCCCACGGTTCTGGCAACATGTACATACTACCTCCGTCCCTCAGTACATGAAC
AAATGAGTAGAATCATTTAACATGTACTAACAAGAAATAGCTGCAACCGGTAACTTGCTGGGGAGCAAGGCCTCCTAGCATGACAGCTAATTGAACATAT
TACCAAGGAACCGAGAAGATGCCAAATGATCTCCAATGGGCAGCCAAATCATCATAGCCATTCAAGAAATAAAAAAATAACAAACAATGAAATATGCATC
CACAGAAGTATGCTGTGAAAGTATGAAACAACAAAAAGAAAGATCACGCTAAAGCTAACTGAATAAACAGTTAACATTCCTTTATTAGTGTTACATTACT
TAATTTTAGAAAAAAGAAACAATTAAGCTCCTATGAGCAAGTATTGTCATCACCGTGCAGTAAGCAAGTTAGACTACAAGTATTGCCCATGATGGTACCA
TAACATCCCCCCATTTATGATTTATTCATTCTGGGAAGACTTCGTGCTCATTAAAGTGCCTGCTGGTAAAAAAGTAAGAACTAAAATACCATTGAGCTGA
TTACCAACAGGATATTGCAATGGGTAAAAAGTAGCAAACTGCCATCGCGAGACATGCTTGCTAATTTGCCAGAGCACTGTAAAATGTCGGTTGTGGGAGA
AGATAACACGAATAAAACAAAAGGAAATAAGTTGCGCTGAAGTGCTGATAAAGACTGAAGATAAATAATACACAAAGACGACTATTTTTTGGTCGGTAGG
GATATCAGCACAGGCATGTGACAATGCTCAATGCACCCATTGGAAATTAGTATTGAGAATTCAAACGGTTGGTACCTCCAATGGGTGAATCCTTTCTGCT
CTAAATCTAGCCAGGAAAACAAAATGATGCAACGCGTTTGTGCAAATTCCGTGGAATACAGAAAATAAAATAAATTTACAAACTCAAATATCAAAACAAG
AGGGGAGATTTTTTGCCTTTCGCCACTGGATAAGATCAAGGCAACGTGCAAGTGCGAATTCAGTGGCATACATGAAAGGCAAAATGAGATTTATGAATCC
AGACAACTCGGATCCATACAAGTACAACCAGGAAAACTAAAGACTGCTTTTGGGTAAAATAATGATTGAAAAGAAAAGAAATATATTTGAATGGCTCAGA
TTAACCTAAATGGCAATTCCAACAGTTCTGAATGCCCGTGGTTCCGGCAACATGTAAGTACTCCCTCCGTCCACTTTGTACATGAACAAAATGATGAGTA
GAATCATTCGTTATAGCATGTACTGAGAAGAAATAGCTGCAACTGGTAACTTGCTGGGGAGCAAGGCCTCCTAGTATCACAGCTAATTGACATAGGCATG
TCCTGTAGCAAAATTTGCCTTGAACATATTACCAAGGAACCAAGAAGATGCCGAATGATCTCCAATGGGCAGCAAAATCATCACAGCCATTCAAGAAATT
AAAAATAACAACATGGCATTTTCTGACATTTAAGGTGGTGTTTGAATCTCCTGAAGATGAAGGCTGTGTTTAGTTCACACTGAAGTTTGAAAGTTTGGTT
TAAATTGGAACGATGTGACTGAAAAGTTGTGTGTATAAAAGGTTTGATGTGATGGTAAGTTGGAAGTTTGGAAAAAAAACTTTGGAACTAAACAGGGCCA
AAGATAAAGATTAAGTGTTTCACGCAAAACGAGGTGGTAATAAAGTGAAATACTATGCCACTGCTTCAGATATCAATGTTGCATTTGCTGACATTTAGTA
GGTATATGCAGAATGGAATGACCCTTTCCATGTGAAAATCAATCACCAAGAAGACCAGATAGAACAAAACGGAAATATTAGGGAAGGACCTAATATCAAA
TAATTATAAGGGGTGAGGCTTCGAACCCAGGTCGTCTAGCCCACCACCTTGTGGAGTTAGCCGGAAGACCCCTAGGCGTTTCTCCGGATAGATAGAACTG
AACCCCATAAAACCATTCGTCCGTATTACTCCAAATCCCGTTGCAAAGCACGGGCATAGCACTAGTGCATGAAAAGAAAAAGGAACTGTAGCCAATGCGA
AGAATACAAATGCTTGAGGAACACAACTGCATCGAGCACCTTCATTGGGCTCAGCTTCGCCTTTGATCAATCAAATAACCCAACCCCCACCATCCCTTAT
CACCAGACCTATCAGTTCTAGCGGTAGTGGAGCTACCCTGGTTATCATTCGAAACGAATGACCATCCAAGGACAAAGCCACTGGCATTAGCACATGACTA
GAAAGGCTCAAAGGGGGTAGAGGGAGGGTCCAATTTAATACCCACAGCAGCCTCAATTGCTTGAAGGCATGCTTATTTCAGCCAAGGTCGATCGTCATCG
CCCTCTGTGTTCATTGCGGACCATACGTAGTACCCTGCCACAAATACAGCATATGCTGATGCGATCACCAACACTAAGAGCAAGTATAATAGTATAGCCA
GATCTACAGCCTGATTTTCTTCTTCTTCTTCTTCTCTCTCTCTCTCTCCTCCAATTGTACCTGCTCTAACGAGCCAAGTCGGCTCAAGCTCACGACGACG
ACCAAAACCCCCAAGAGTCCACAGCCGATCCGGACACCACCCTAGGTTCCAATTGCCTTCACTGCACGGCGGCGGCTCACCTTAGAGATGGGAATCCGGA
CGCTGCGGCCTCTCGGCGGATTGATCGTCGGCAAGCTGTGGGAAGGAATTCCTGCGAAACCCCTTTTAACAATGGCATAATCTCCAATTTCTCGTCGTCA
GCAAGCAACTGCACTTGACATTGGGTCGGTTAGGGTATAAACACACAAGCACACAGCACACGGTGCGCCATAGAGGCCGTGAGGGAGAAGGACGAGGAAG
AGAGATTGTGGTGGTGATGACCGAATCTCGAAAACGTGGCTAAAAACGAAATCGAAAGAAAATCCATGGCGAGGCGGCTCAGATCTCACCTTGGCCGACC
CGC