Detailed information on CNT30101186


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000896, E-value = 1e-94

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696343Oryza rufipogonOryza sativa50.8119.997.38344forward

Expression of CNT30101186

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MVEYLARIELVFEFISKTEFCFSRVDFLREESDLFNPRL*

>peptide 2 (59 aa)
LALFIFKLGQSRAARAVPCAATASSVKSATSRAPFAKLVEGKYSSYPPLSFPPRIGANG*

>peptide 3 (37 aa)
WHCSSSNLDRAEPPVLCPVQPPLPPLNPPHPELRLQN*

Sequence

>CNT30101186
CTGGCACTGTTCATCTTCAAACTTGGACAGAGCCGAGCCGCCCGTGCTGTGCCCTGTGCAGCCACCGCTTCCTCCGTTAAATCCGCCACATCCCGAGCTC
CGTTTGCAAAATTAGTTGAGGGGAAATATTCCTCTTATCCTCCTCTATCCTTTCCCCCAAGAATCGGAGCAAATGGTTGAGTATCTTGCCCGAATCGAAC
TCGTTTTTGAGTTTATCTCCAAAACCGAGTTTTGTTTTTCCCGAGTCGATTTCTTGCGGGAGGAGTCCGATCTCTTCAATCCAAGGCTATAAATAGGACC
CCCTAGTCCTCCTCTTTCGTTTGCCCCTTTTCCCAAGCCTTCCCGTGACCCGTAGAGCCGTCGCCGCGTGAAACCATCCGCCGCCGCCGCCGGCCGAAAT
CCGGTTGCGCCGCCACGCCGCCTCCGCCGTCTCCGTCGCTTGCCGTCGCCGCCGTTGGTTTCGCCAAGAGGTGGAGAAGCTCGGCCGCCACCTCTCCTTC
GCCGCCGGCCGCCGTAGCCCGTCCCCACCGGCCAACCCGAGCCGCCGCCGTCGCCTCTTCGTCGCCGGCCGTCGTCGTTCGTCGTTTGGTTCGAGGCTTG
TCGTTTCCATCGATGCGAAGGTTCGTGAGTGCGCCGGAAGTATTCAAGAAGATTAATTGAAGACCGATTATTGCAAG