Detailed information on CNT30101002


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003666, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30575875Oryza rufipogonOryza barthii70.5952.4599.411351forward

Expression of CNT30101002

Peptides detected in this lncRNA

>peptide 1 (72 aa)
LSPIAPLYIPSQPPSTPFTIVGAAPSISTSAPMSAPPQHPSQRRHRSAPPEHPRLSLSSVPLPPPPAPAVNP*

>peptide 2 (69 aa)
SLPSLPSISHLSHRALPSLSSAQRPRSPPARQCPRRRNTQASDATDPRRRNTRASRSRLCRSPHPLRPP*

>peptide 3 (67 aa)
MEVVLPAGFFLALDWWDPLQRVQEAPSSSWFILDWIKNLRRNVNFQYLIRSCFIWGSYLHMASDHLF*

>peptide 4 (55 aa)
MRHIGNLVSWLILAFLFFRSDKFQVAIYKDLFWQDYQVAWNLGGKVNIYAQHRQQ*

>peptide 5 (52 aa)
MQVCFLSASPFICQFVLIMHGCMLLILFLCVCKLQTTALSLVQMGMGSLRAV*

>peptide 6 (46 aa)
MKIMVEYSVFRSMEAICRGKMCNNCSLFCCNNLGDELRTEFPNLIA*

>peptide 7 (33 aa)
MAHADQQCCRGRHLHRHRHLLGEVPPSSPSLTN*

>peptide 8 (75 aa)
MFVVIGFACIYTISCASNSSPQRYKSSISGSVSTSIYSFLSVELPNYIRYYIYFYAPYWKSCFMANISILIFQIR*

>peptide 9 (93 aa)
LSHRSPLYPISATEHSLHYRRRSALDLHQRANVRAAATPKPATPPIRAAGTPAPLALVCAAPPTPCARRKPLILRAPLALLTISSAPPPFSCQ*

Sequence

>CNT30101002
CTCTCTCCCATCGCTCCCCTCTATATCCCATCTCAGCCACCGAGCACTCCCTTCACTATCGTCGGCGCAGCGCCCTCGATCTCCACCAGCGCGCCAATGT
CCGCGCCGCCGCAACACCCAAGCCAGCGACGCCACCGATCCGCGCCGCCGGAACACCCGCGCCTCTCGCTCTCGTCTGTGCCGCTCCCCCCACCCCCTGC
GCCCGCCGTAAACCCCTAATCCTCCGCGCTCCCCTCGCCCTCCTCACGATCTCCTCCGCGCCACCTCCATTCTCCTGCCAGTAGCCAGCCTCAAGGCCCT
GCGCTACCCAGCCGCCCGTCGTTGCCGCTCCTGCTACGTGGATCTGGCGGCGGGATTTGCAACGGGGACGGCGTCGCGCCCTGCTCGTGCTGGCACAGAG
GTTGGGGAGAATAGGATGTAAAGGTTCCTTGGCTTTGGTGAGTTATTCACCGTGATGCAGGTTTGCTTCCTCTCCGCCTCTCCGTTCATCTGTCAATTCG
TGCTGATTATGCATGGCTGCATGTTATTGATTTTATTTTTGTGCGTTTGCAAATTGCAAACAACAGCTCTGTCCCTGGTGCAAATGGGAATGGGATCGCT
CAGGGCAGTCTAAATCATGGAGGTTGTTTTGCCTGCAGGTTTCTTTCTTGCGTTAGATTGGTGGGACCCTCTCCAACGTGTACAGGAAGCTCCTTCCTCT
TCTTGGTTTATCCTCGATTGGATTAAAAATCTTAGAAGAAATGTTAATTTTCAGTATTTAATTAGGAGCTGTTTTATCTGGGGATCATATCTTCATATGG
CCAGCGATCATTTGTTTTGATGGTTTGACTTTGTTTCTGCTACTCAAAATTACATGTTTGTCGTCATCGGGTTTGCCTGTATATATACGATTAGCTGTGC
TTCTAATTCCAGCCCCCAACGCTACAAGAGTAGTATCAGTGGAAGTGTTTCCACCTCCATATATAGTTTCTTATCAGTAGAATTACCGAATTACATCAGA
TATTATATATATTTTTATGCGCCATATTGGAAATCTTGTTTCATGGCTAATATTAGCATTCTTATTTTTCAGATCCGATAAATTTCAGGTTGCAATTTAC
AAGGATCTCTTTTGGCAGGACTACCAAGTTGCCTGGAATCTGGGGGGAAAAGTCAACATTTATGCACAACATCGGCAGCAGTGATCTGCCGTGCATGACC
ACACCGATCGGATACCTCCTATGCCTATATCCTGTTATTTCCAGTTGACGTCCGTAGTTCCTCCTCATCATTGAAGCTTATATCGATCGACCGATTGAGG
CATGGCCCATGCTGACCAACAGTGTTGCCGCGGCCGCCATCTTCACCGTCACCGACATCTCTTAGGTGAGGTTCCGCCATCTTCACCATCACTGACAAAC
TGATCAGTTAATAAATTGTTGTCTTCTCCAACAAATACATGATACATCTACTATTCTGTACTTTCTCATAGTTACTCTGATTCTCCAATTGGTTTCGATT
GAGTTTCTATCAGTTTTTTCTCTCTCTGTCAAAACTACAAGGGAAGGCCATATATGCCATGAGACTGATTGCACTGCAGAACACGTTCCTTCGTGCCCGG
TAGTGCAATTTTATTTCTCTATTGCTACGTGTGGTGAATGAAAATTATGGTGGAATATTCTGTTTTTAGATCAATGGAAGCTATATGTAGAGGTAAAATG
TGTAATAATTGCAGCCTGTTTTGTTGTAATAATTTGGGAGATGAATTAAGAACTGAATTTCCAAATTTGATTGCATGATGTATCCAATTTAGGGAATGAT
TTGAGTTATAAATCCTTTGCTTTTATGTCTGAAACCATATTTGTACAGCATGTCAATGAAAATAGTCAGTGTCATGTATATATCATCACTATCCATGGAT
CAGTTTAGGTTTTC