Detailed information on CNT30100645


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FLF0|RS92_ARATH, E-value = 4e-47

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671476Oryza rufipogonSetaria viridis11.8934.639080forward
CNT30555382Oryza rufipogonOryza glaberrima42.0522.9994.7283forward
CNT30144538Oryza rufipogonMedicago truncatula8.3220.5987.556forward
CNT304757Oryza rufipogonZea mays32.5488.3187.21219forward
CNT30342367Oryza rufipogonEragrostis tef24.8154.489.22167forward
CNT30367296Oryza rufipogonSorghum bicolor43.8354.5388.14295forward
CNT30595996Oryza rufipogonOryza meridionalis66.8681.2396.89450forward
CNT30369943Oryza rufipogonOryza glumipatula27.3474.49100184forward
CNT30117069Oryza rufipogonOryza nivara74.2989.6197500forward

Expression of CNT30100645

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MIITETTSCKLLFSFLIFLLTVTATATCLLLVLPLHPTRGASTEWACQ*

>peptide 2 (34 aa)
MRRSSASPSKMRRGFFSSSVSRCLALLRIRLKAY*

Sequence

>CNT30100645
GAGACGCTACTAAATTAATCTTAACAACTCCATAATCCATGTTGCAACTTCGAATCCATAAAAACATTAAAAACAGCATTGGTACGAGTGAGTATCACTA
GTTCAAGCGCACTGGTACGATGAGGATTACCATGAAACGAATCCATAAAACAGCATTAACCACAAGTCTATACCTAACATAATGCCAAAAAGGGCTAACA
TAAACCAACACCTGAAGCACAACCTGCTTGAATTCTGAATCCCAGATAGGCAAGCTACAGAATTTGGGCCTAGTTACTCAGCACAGAGTTTTATGATCAT
TACGGAAACAACTAGTTGCAAACTTCTTTTCTCATTCCTCATCTTCCTCCTCACCGTCACCGCCACCGCCACTTGCCTTCTTCTGGTTCTTCCTCTTCAC
CCTACCAGGGGGGCCTCCACCGAATGGGCTTGTCAGTGAGAAGTCAATGAAGTTCTCAACAGTGAGGGCAAGGACATAATCAAGCTTGTTCTGCCCATCA
GCAAGGAGCCCATAACGGTTCATGCGGCGAAGCAGTGCCTCACCCTCAAAGATGCGGCGTGGATTCTTCTCATCAAGTGTGAGCAGATGCCTTGCATTGT
TACGGATACGGCTCAAAGCATACTGAACACGCCACAGCTCACGCTTGCACCTCAGTCCATACTCACCCNGTAG